DPCstruct | MC9865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 117 ± 25 aa |
| Standard deviation of domain lengths | 24.88 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 75.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4KD31 | 1-83 | MSYYEFGICPYNPDHRIMLFRMPGHIVKCKKNYRGPPLQICKYNATHRVLDMEEHLKECTYYRNYIDTQAVRIALTVRKAPTE |
| A0A7M7PUI0 | 4-113 | EEPLEVCPFDKSHRIRGSRMAYHIRRCANSHPEIQLKICPYNSRHILHPKQLSEHLRSCPTKEFANPDKIVETTPETSGVIIPVQPE… |
| A0A1D2N9E4 | 17-186 | None |
| A0A182F526 | 4-130 | None |
| A0A6P8JME7 | 3-140 | None |
| A0A1A9XRS1 | 8-140 | None |
| A0A7S3JNN9 | 1-162 | None |
| W5MAD3 | 4-123 | None |
| A0A1A9XQI9 | 1-145 | None |
| A0A340Y675 | 6-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.