DPCstruct | MC9864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 91 ± 8 aa |
| Standard deviation of domain lengths | 8.24 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 35.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V1EC81 | 1-80 | MLIRKGNELLNDGDIEKAEKIFVTTAYKDGLIRIGDYYYFDQKNVFKALNLYLEAKYEKRIRELTERMALVLKNWLNEGN |
| A0A847M2E6 | 5-94 | TRPELDSVQKVQLNRKGNELFNKGDIKGAERIFITTGYSDGLIRLGDWYLSQGKQLEALKMYWLAPDKKKAEPLIEKAAALIQKLLE… |
| A0A660TZW0 | 16-103 | None |
| I4B8Z6 | 1-82 | None |
| A0A1I1DBX6 | 1-93 | None |
| A0A5C8EKF0 | 1-109 | None |
| A0A1G3L7K0 | 9-101 | None |
| G0GFT9 | 36-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.