DPCstruct | MC986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 147 ± 13 aa |
| Standard deviation of domain lengths | 13.26 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 65.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19762 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q2M9Z5 | 147-288 | AERMHEQAFKVHEESRRGYHPSGLEMEWLIPVVAILAVFGTPILIVWLVTRNSYRKKQLVMENINRMVSEGRDIPPELLDSLDSESS… |
| A0A2V5MSE7 | 1-132 | MGHHNDDIPGSVLPIVIISVLAVFGFPVAIVAVIMFSSWARTRSLHRTVRMMVEKGQPVPPELLSSPAAAPVTVRPWYDLRRGIVLV… |
| A0A316SYT0 | 9-173 | None |
| A0A127R3X7 | 1-134 | None |
| A0A1F9N8B2 | 78-215 | None |
| A0A2V5VX56 | 25-187 | None |
| A0A374W8D4 | 21-189 | None |
| A0A1G4PDS1 | 1-124 | None |
| A0A1Q3HN05 | 92-236 | None |
| A0A7W0YBF1 | 77-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.