DPCstruct | MC9859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 207 ± 25 aa |
| Standard deviation of domain lengths | 25.29 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 17.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A3TMT1 | 4-219 | ELEYLDTIPACTSDGTRVWLRNNSDVVWTISFPTNAASQRTSAEPVAESYRSIVDGNAPGYAVFAPQDQIVVDAPPTAVSLKLNTQL… |
| A0A4R0JDC6 | 77-271 | MDGVRLDASTDATQTSLLLKNTGLLSVVVIPDERWTTRLTAARHANPTDPASVAALAAVTGSGGLSAVTELPTGFPSSQAVIVPPGW… |
| A0A4R8ZZW7 | 43-212 | None |
| R1I274 | 137-335 | None |
| A0A386ZB22 | 134-309 | None |
| A0A3P5X6F9 | 107-375 | None |
| A0A4Y9QCW1 | 44-250 | None |
| A0A2S5YGV4 | 6-195 | None |
| A0A0L1M0J4 | 97-293 | None |
| A0A1H9W9N8 | 223-418 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.