DPCstruct | MC9853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 187 ± 32 aa |
| Standard deviation of domain lengths | 31.79 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0J197 | 4-159 | YPRPARDGKKHHVNQKYTTEEGDYIIYASQDKKMKWHLIKQEFAKLFGNIPERTVQGLQAWYYRMNQRIPMCNPDGRLCFNNEDDLE… |
| A0A094BJ30 | 19-175 | NGGGGMVQRSSRSPSPTLPAHSNVPYTLEQVHFIQYYREDKGVQWEAIVIPFKKQFPQVRFKPSTGPNRGKGALECRYYRAQMFPKL… |
| A0A2U3EJG0 | 599-802 | None |
| A0A132B5S1 | 62-255 | None |
| A0A094II80 | 1-241 | None |
| C9SVC0 | 6-172 | None |
| A0A5N5NTJ4 | 209-470 | None |
| A0A5N5MSU4 | 87-304 | None |
| A0A1J7JIP1 | 163-372 | None |
| A0A4Q4XRJ2 | 134-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.