DPCstruct | MC9852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 90 ± 13 aa |
| Standard deviation of domain lengths | 13.23 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 71.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03660 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H9TJD7 | 1-81 | MCRKLPGIVVGKLCERCDGRCVLCDSYVRPTAAVRICDECNFGAQRDRCVVCGGPGSTEAFYCHACCLQEKDRDGCPKIVN |
| A0A094B8D5 | 1-95 | MSRHHPDLVMCRKQPGISLGRLCDKCDGKCPVCDAYVRPTTLVRICDECSFGNYQNKCVDGFVLPEKTAKGVWDERMRRLRRQFTMT… |
| A0A4Y2UIH9 | 1-95 | None |
| A0A2R6QSU7 | 1-67 | None |
| A0A6U4SPQ9 | 63-153 | None |
| A0A5E4AIS3 | 1-105 | None |
| G3I5G6 | 3-84 | None |
| A0A4U5QCF6 | 173-269 | None |
| A0A2P5ELI4 | 14-90 | None |
| A0A182ECX7 | 4-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.