DPCstruct | MC9851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 127 ± 23 aa |
| Standard deviation of domain lengths | 23.03 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9UNQ9 | 135-254 | PLVLVFNKTDVLPADFATEWMADCEAFQAALDGEKAYIGSLSRSMALMLDEFYSQLRAVHVSALTGDGVPELLDALQTCAHEYQESY… |
| A0A094B0N2 | 16-170 | AKEWMTDFEAFQESLRQEEEEGSFGGVEGGVGVGGGSGYMGSLLNSMSLMLEEFYSHLSVVGVSSMTGDGIDEFFEAVQEKAEEFNR… |
| A0A5J5C8L9 | 16-112 | None |
| A0A7S4PEA6 | 234-373 | None |
| A0A4Z0YTK4 | 190-336 | None |
| A0A0C2MGD2 | 8-129 | None |
| A0A7S2UKT3 | 2-129 | None |
| B5VLM4 | 16-163 | None |
| T1GY99 | 1-102 | None |
| A0A0G4MBS2 | 370-516 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.