DPCstruct | MC9848
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 241 ± 33 aa |
| Standard deviation of domain lengths | 33.32 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316MDT4 | 189-483 | LSPDEREFAAEMLTDIYLHPSVLRRETFRDQMSAANALLWTRLTSRDLRLPPLASLEFQHLCGILVAGDIQRPGTLVHDLLLEPELT… |
| A0A0G1XYY2 | 1-221 | MIYLEIETIVTELLLRYHLKNENSLIHQVLFNSARAALAKNHLNEIPGAFSTEKNWGTHFFWGLDEKGHRVRMFLNNFNSLRSADGE… |
| A0A1F6SGC0 | 83-298 | None |
| A0A3Q8YLI4 | 83-335 | None |
| A0A212DRR0 | 95-325 | None |
| A0A1F6M9V9 | 1-227 | None |
| A0A0H3ABE4 | 252-560 | None |
| A0A0G0WPP3 | 48-248 | None |
| A0A0G0HSD4 | 103-323 | None |
| K1Z3A0 | 53-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.