DPCstruct | MC9844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 131 ± 12 aa |
| Standard deviation of domain lengths | 12.44 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A178IGE8 | 24-155 | HRELLHHIEAGETLLFRVLRGYIGAALWTSSDDNGTPLDRDHGIADLAVESLISAWVECSCFCRECETDLTHLDDERNGHDFWLTRN… |
| A0A398BX26 | 9-162 | RDEAARRESQFVFGFIEAMFFTETEPGTCIAEWHDAEAVAMRESGQWAALPGDAGYTDLHPDTLARIRADCEAWQNAHVDLLALAYD… |
| A0A0S9PZS7 | 108-246 | None |
| A0A4R5GF31 | 215-331 | None |
| A0A2D9CKQ6 | 8-114 | None |
| A0A7S7ZIP5 | 35-160 | None |
| A0A1Y0ZCM3 | 92-225 | None |
| A0A3N8I9I0 | 75-211 | None |
| A0A5C7Q0G2 | 57-186 | None |
| A0A3S0FG69 | 2-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.