DPCstruct | MC9843
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 155 ± 10 aa |
| Standard deviation of domain lengths | 9.64 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I6XAM1 | 2-154 | HFGFSYVGLIFMAMLFTPNIIWTKNQPQNYEKYACNENKILLLFERVGEVSVTCLMLIFKDLNFQGVNTWMVWFLLAAFLMVLYEIY… |
| A0A2V2FHS8 | 1-162 | MTIEISLWSAVTLAALLLPNLLYVFFKPVNPEKAEPPKPFFGWLEQLGRMGCILLMCVNIGPFQFGFRGDAAFAIWLIAVAGCIAGY… |
| A0A844JI29 | 1-151 | None |
| A0A415E422 | 44-196 | None |
| A0A374NCS9 | 1-140 | None |
| A0A4R1ARM5 | 1-154 | None |
| A0A1Q6LKD5 | 3-164 | None |
| E6MH99 | 330-488 | None |
| A0A1G4VYW0 | 22-156 | None |
| A0A1C5KYZ0 | 253-421 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.