DPCstruct | MC9840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 126 ± 11 aa |
| Standard deviation of domain lengths | 11.12 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16693 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A089ZQB4 | 80-199 | RDRLDQAGLQPLSIDTQGDTLRVSGLVDSDQRTRWIEVQNWYDRTWGNTPVLRNDVQPAPLVPPRVHFQAVWLGPQPYVVGERGERL… |
| A0A249P5J9 | 59-177 | QQEVDRAGLSNIKISAAEGVVTVEGTVTSASAISWHKVQQWFDHRTRGALALLNGVIIDDEKAPSAIAVEAVWRGSLPYLVIKGEKY… |
| A0A1M3CUX2 | 579-702 | None |
| A0A2W7GJF0 | 246-374 | None |
| Q72WH6 | 444-597 | None |
| A0A157SHX2 | 173-291 | None |
| A0A5C7NKQ5 | 341-470 | None |
| A0A126S481 | 3-124 | None |
| A0A4Q3QK85 | 117-247 | None |
| A0A6I6SIB3 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.