DPCstruct | MC984
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 130 ± 22 aa |
| Standard deviation of domain lengths | 21.53 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 25.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1VPJ2 | 2-98 | LGGLAAGLIATVVVSLMLIFPDATADRNRGLTTPMPEPRLQTDPPADFKRYRERSMERLTGYGWADHERGIAHIPIDEAMRRVAEHG… |
| A0A2V5MQU6 | 3-154 | HWPMQNDPHNSPLSKEALSRKHESENPAVGRILFVAGLVALLLIGSLVIIWALMVLLMRARPLDRTAGERSVITAPNQQPLDRFLAP… |
| A0A2S8H026 | 3-104 | None |
| A0A5B8SXL7 | 16-149 | None |
| A0A2D8Q7Z9 | 14-133 | None |
| A0A328LVA1 | 1-115 | None |
| A0A4V1US20 | 11-156 | None |
| Q02BR1 | 8-136 | None |
| A0A2V9R421 | 1-164 | None |
| A0A2V8HPF1 | 2-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.