DPCstruct | MC9839
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 107 ± 8 aa |
| Standard deviation of domain lengths | 7.82 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 74.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 40.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03206 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L3L9R2 | 2-92 | LGVSYDPKVLDVSRLHIMKRMGQYLAEEDFSGLPDQVIAARAHAMLERAYEDFATSSPLKHRVFKVLKDHDPDNPATSARAFVPLDS… |
| A0A249P552 | 7-119 | TFAPDGTDILTWLKDLSAAEEFFDALGVTYDPKVLNTSRLHIMKRMGQYLVAEDFSDLLTGTAATRARAALERAYRDFATSSPLKHR… |
| A0A110B587 | 26-142 | None |
| A0A037UW45 | 4-107 | None |
| Q60C56 | 4-97 | None |
| H8FPN8 | 2-97 | None |
| A0A7D5MX35 | 9-114 | None |
| A0A7S7UZ53 | 5-110 | None |
| A0A2S8RF51 | 2-110 | None |
| A0A1S1T1I1 | 13-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.