DPCstruct | MC9838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 131 ± 18 aa |
| Standard deviation of domain lengths | 17.64 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G8EA61 | 14-137 | AQVERDLAAENRSLEVFLGGLQTLWHSSQPKRRKSKPRSGKRTRPDPFEPDVALIEQWLQAEPLIRAKTLMERLIAHNPERYGECHL… |
| A0A249P419 | 9-133 | TPPAMRTDGVAQPIDLFLASLRTAWQDGATRPTDRPIVKAKRGRRRPDPLVKATADLRNWFEAEPWRTGSELLSRLQAEYPGDYPDK… |
| A0A3Q8YYF8 | 237-338 | None |
| J6DEN4 | 76-200 | None |
| A0A4Y3ZWU8 | 2-114 | None |
| A0A1I2GNJ5 | 27-147 | None |
| A0A0S9RDX5 | 5-142 | None |
| V4RDE8 | 1-126 | None |
| A0A1Q7IF10 | 4-172 | None |
| A0A6F8NHL4 | 60-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.