DPCstruct | MC9837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 141 ± 13 aa |
| Standard deviation of domain lengths | 12.88 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T6D6U3 | 1-147 | MRALTMKGVLLAISVIFTFSGCCEYKVIQRFSLANGVSVEILRETEWEHSPILFYTVRESGSVRVPRTFFDTAGDEELQMIDSDKGV… |
| A0A3A4SP59 | 31-168 | IYPCGKSKVTAIKIDDKRSIVISSEDCWEISQGLIYQIPASSLSARFGGTIESTDGLKFLSLNAENSNLVAIVEAANPDVVLILHDF… |
| A0A2S4N4W2 | 30-154 | None |
| A0A519M688 | 1-138 | None |
| A0A517VST1 | 56-181 | None |
| A0A661V139 | 1-147 | None |
| A0A2E9QVX0 | 1-164 | None |
| A0A6P2CWG2 | 6-165 | None |
| A0A7Y0I6I9 | 16-146 | None |
| A0A518FUT1 | 56-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.