DPCstruct | MC9836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 728 |
|---|---|
| Mean domain length (aa) | 328 ± 85 aa |
| Standard deviation of domain lengths | 84.84 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 87.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 16.28 |
| Pfam Score | 96.90 |
| Assigned Pfam label(s) | CL0023- CL0323- CL0063- CL0059- PF03981 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A533IST2 | 1-230 | MNIGIDKINFYVPKYYVDMAKLAEARQVDPNKFLIGIGQTEMAVSPVNQDIVSMGANAAKDIITDEDKKNIGMVIVATESAIDNAKA… |
| A0A2T6CSV7 | 9-318 | GWITPVGRTPAEAISRVKDHLPATPDQPEGYETPVLPIDPAFIQDVSGIPRLRRSSVISHFAVAAARDAMAGISLSEDELANLPLLF… |
| A0A4Z1HBH7 | 361-794 | None |
| K2S8N3 | 373-645 | None |
| A0A511TD03 | 441-913 | None |
| A0A811MYY2 | 374-774 | None |
| F4PPZ1 | 740-1126 | None |
| A0A1B0C4L7 | 12-232 | None |
| A0A068UJA7 | 64-473 | None |
| A0A1Y6C1L2 | 3-421 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.