DPCstruct | MC9835
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 273 ± 34 aa |
| Standard deviation of domain lengths | 33.80 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z3BKJ6 | 29-280 | RDDIWLWFYLALRGKALYRSEALNPRTMSEQMAESIKSFRLSLEEIAVDQNRQMVSEGHITWISDCKRQLAWIQHRLNRDKRIRTPD… |
| A0A2W0GS71 | 73-407 | QIDDSVINKFDIRKLRMALVTLAEAGADMSDHVFINPGNSSPARERNRYLFIQRPFHNRLELITLVKRYARRSRFMDEGMQAFNQAV… |
| A0A609CIQ3 | 3-250 | None |
| A0A1H7MIR6 | 2-227 | None |
| A0A0Q0TK69 | 4-229 | None |
| A0A837PUN6 | 10-279 | None |
| A0A1T1I7G1 | 2-254 | None |
| A0A5C2AXG3 | 5-244 | None |
| A0A2U3EYV2 | 33-297 | None |
| A0A0M9FA95 | 56-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.