DPCstruct | MC9834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 102 ± 15 aa |
| Standard deviation of domain lengths | 15.04 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401X4N9 | 1-93 | MPANQIVLFASGTGANTYAPAVWSTRPEVSFGYQVGIADATSVNTALRQASFVAAMIGQYTADLSGKDTLDNGDIPTFENNFKSALS… |
| A0A2W0G7M5 | 3-97 | NKNDFKAFALDPNANVISQANWEALPALLSGFTAGKASSAQVNKAIRQATTIAALVGQFIANSGVDALDNADVNSLVTKFTNALTTN… |
| A0A3B0M0V6 | 2-107 | None |
| A0A833N4C4 | 1-97 | None |
| V0AS04 | 1-97 | None |
| B6I7Q3 | 13-158 | None |
| A0A1B8YLM7 | 1-88 | None |
| A0A843H7S4 | 6-100 | None |
| A0A022PQJ8 | 1-99 | None |
| A0A1S1HRI1 | 2-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.