DPCstruct | MC9832
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 144 ± 26 aa |
| Standard deviation of domain lengths | 25.96 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02119 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5P7S2 | 169-347 | SLYKSSAKNADLIETKINKKFGRRLAYAVDTRSIRVNKPDEISIIKFISMIENIPLSSDFKKKIIIDMNRESIIAGADIEISPVTIA… |
| A0A7V1II89 | 6-157 | ARARDSGTLDITIPEAFRGDVVGFLARVEMLDIAPDRKARIILNERTGTVVMGDAVRIGTVAVSHGNLTVVVNRTNQVSQPAPFSQG… |
| A0A7Y3NHA9 | 6-120 | None |
| A0A3M1DX48 | 387-530 | None |
| A0A3N5IGZ9 | 28-210 | None |
| A0A3L7TH76 | 315-482 | None |
| A0A2D7EE90 | 41-168 | None |
| A0A1A9Z125 | 762-916 | None |
| K1YNE2 | 1-99 | None |
| A0A661J1T0 | 98-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.