DPCstruct | MC9831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 437 ± 67 aa |
| Standard deviation of domain lengths | 67.41 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 20.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0Z242 | 3-364 | GSLLGGDWSWKRARDSFYKGLTSLDKASREKHFSDAFRALGQIMHLIQDASVPAHVRNDPHIYIDLFGRKIGKYHYESWVQDNLAKI… |
| A0A7W1MKX3 | 26-342 | ASLPGRGMPAPAWVTHAKNPLNLENFYSQYTKAVTATSPGERSRHMAAALVAAGAILHTLGDLGTPSRVRGDEAAHLQPLGGGPDDL… |
| A0A7Y3U694 | 61-561 | None |
| A0A3A6PLZ4 | 44-422 | None |
| C7LS57 | 6-559 | None |
| A0A1V4XJF3 | 2-552 | None |
| A6GFH2 | 636-988 | None |
| A0A1V4YXX0 | 6-458 | None |
| A0A1B4XEW0 | 21-514 | None |
| A0A5S9NVK2 | 86-483 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.