DPCstruct | MC9830
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 115 ± 18 aa |
| Standard deviation of domain lengths | 17.99 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0TSY5 | 25-133 | FTDVEEFINSITDLPALPSNIQKINELLMDENTCADDISRVISSDQSLTTKMLKTANSAYYGRLSRVVRINDAVVLIGMTNLKSMLY… |
| A0A4P7R955 | 45-175 | ELPALPLALMVAVQALSSDDLPASACVDAVERDQSLAVRLLRLANSAFYGARGHVASVEDAVGMLGLRTVASVVAAVSMRSTLALVP… |
| A0A3M1TII0 | 476-615 | None |
| A0A1Z9IHB5 | 133-240 | None |
| A0A3D6BYF2 | 197-308 | None |
| A0A1E7HVR6 | 143-288 | None |
| K1UKB6 | 32-149 | None |
| A0A3D0SQY8 | 3-127 | None |
| A0A1Y6BFW5 | 64-166 | None |
| A0A1C2HX79 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.