DPCstruct | MC9829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 416 ± 105 aa |
| Standard deviation of domain lengths | 105.04 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 84.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 21.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0QJH4 | 65-455 | ELVNGKPGYLLKTDNWAYYIEPQVSLGEDEGIYIPSKADFVFRPVREHSGIKPIAVFADGYMYHKDRIGQDMAQRMAIVQSRRYHVW… |
| A0A7K2VAG0 | 6-327 | PDFELSTNDSEIPRIALFVDGRRFHAMPGCNRVADDATKRATLRATGHLVWSFGHEDLQRFKNNETVTPSWYTEGAASNTMKAGNLR… |
| A0A7K2Z7P0 | 71-677 | None |
| W4TS89 | 520-827 | None |
| A0A0G3G7W1 | 7-282 | None |
| A0A2W4X5Y8 | 699-1159 | None |
| A0A7J0CZU7 | 61-760 | None |
| A0A6B0ZV05 | 199-613 | None |
| A0A7X6WYS5 | 90-550 | None |
| A0A2D4TXE7 | 1-340 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.