DPCstruct | MC9826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 189 ± 7 aa |
| Standard deviation of domain lengths | 6.89 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 86.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.17 |
| Pfam Score | 77.78 |
| Assigned Pfam label(s) | PF13682- PF01584 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1XS05 | 168-363 | QREEDHRRWLTTLEDSVRETKEFTLALDPHKCKFGLWYDSYETSNYFVSNILKKFDVPHKKIHGIGNKVMGLSRKGNKDRAYDIIDK… |
| A0A2L2X5F7 | 14-202 | SFVEDHKKYVEELLNSIDTGISPALTLNSHQCPFGVWYDNYKPTNNLVINHLKKIDEPHKRLHVIGAEVVKLLSSSRGDSEERLQAL… |
| A0A2A4RH10 | 114-308 | None |
| A0A7V0J0N2 | 17-202 | None |
| A0A831P5T7 | 264-463 | None |
| A0A255QT32 | 109-294 | None |
| C5BRB5 | 96-272 | None |
| A0A2U3LPC3 | 222-413 | None |
| A0A2N9N7W4 | 162-344 | None |
| A0A661CFU0 | 2-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.