DPCstruct | MC9822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 113 ± 14 aa |
| Standard deviation of domain lengths | 14.44 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6VUY1 | 18-108 | ATKLHVNKGYITVDDAAVRSSIDVSPPVTIYARFDGSSNKEKVKPGCKLEAKWPSNYGDIYFGEDNCLYDSKGQNINGQCCKPSGNL… |
| A0A6A6QAM9 | 534-651 | PTSTPIPNPAGTAVHVKNGCASINGSPRCDSDSTFDSKYNVADTNQPYANAAIYGNFDKTNSMAGNVQPGCKLQAQWPANYGDVYFD… |
| A0A0A2JFD4 | 557-666 | None |
| A0A0A2JY74 | 117-221 | None |
| A0A0A1TDW7 | 825-942 | None |
| M2RXF6 | 14-99 | None |
| A0A135LE17 | 66-190 | None |
| A0A135LN51 | 571-683 | None |
| A0A135LRF9 | 298-415 | None |
| A0A1V6SZF5 | 57-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.