DPCstruct | MC9820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 149 ± 15 aa |
| Standard deviation of domain lengths | 15.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H8R236 | 126-287 | DRTPLFLDEATLALYNRAINDPSSLTDAERRTITNRPPPEEEDSLCRAACGLSFSELITKAIQNSDSLTYKEGHLVTAGVVPNQAGR… |
| A0A5N6VEM1 | 2-145 | CTMFTPYERPPPKIPSQEIVERWEQGATDPASLTFDERQHLLNRYPYGKCNDFCKAHTGLTIEELVQKAARTDDLSRLETDIIVWGP… |
| A0A1V6RLQ3 | 8-151 | None |
| A0A6V8QLU6 | 9-150 | None |
| A0A3D8RHS1 | 1-162 | None |
| A0A093YVW1 | 399-547 | None |
| A0A395SKI2 | 62-199 | None |
| A0A397HFC0 | 124-250 | None |
| A0A6J3MDX6 | 34-172 | None |
| B8MG09 | 30-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.