DPCstruct | MC982
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 320 ± 28 aa |
| Standard deviation of domain lengths | 27.70 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A413B3H8 | 285-600 | GTNLADELTSLNYYTILSDEEPASVYTNANQRSFRITEPLQINMENDSLHMRFYSPVGIKEVTVMAKSPTMDEYVEFVYIDDIPAFA… |
| A0A847SGP9 | 1-300 | MFQDNEPLSVMTSTDRQFEVAKIIRVRAITADTIEIANFAPTDITDASILMTVSGMPTPLHLLHIKAIRAHAIQKIRYPFMTGTAKC… |
| A0A855RZJ6 | 393-708 | None |
| I0EPV6 | 190-532 | None |
| I0ELU7 | 68-403 | None |
| F4LM01 | 65-401 | None |
| A0A496P417 | 96-413 | None |
| A0A7L8A6K2 | 19-325 | None |
| A0A5N4FQ78 | 577-924 | None |
| D0ST58 | 1-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.