DPCstruct | MC9819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 316 ± 39 aa |
| Standard deviation of domain lengths | 39.41 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 13.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F0TUF8 | 87-395 | KNRYYIYINSRNNLSLIYNKKPSLNHLYNRDAEYKGTKVIGEEIHLYFEFVSKYFLPTSMSSTIVIRKTKKQINIPVDKFDCFKESN… |
| A0A6M1XC12 | 4-306 | SKIYIDKIYWERVQLFVEGHSENLDLEDSNFVLRNLTETRTMKANDVKIDGNQFVCRFNVAILDNGYYLPEDKYLLVNEQELDYIAQ… |
| A0A1M6JAK5 | 553-817 | None |
| H1LGQ2 | 1-335 | None |
| A0A3N5BZC8 | 323-635 | None |
| A0A843GDV9 | 20-321 | None |
| A0A1V4E4L8 | 304-613 | None |
| A0A4Q9ZHB2 | 594-952 | None |
| A0A7K1FB80 | 144-435 | None |
| A0A562BZM3 | 341-598 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.