DPCstruct | MC9818
Metacluster Properties and Pfam Annotations
| Number of structural domains | 170 |
|---|---|
| Mean domain length (aa) | 167 ± 29 aa |
| Standard deviation of domain lengths | 29.10 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.15 |
| Pfam Score | 99.30 |
| Assigned Pfam label(s) | PF04563- CL0410 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1XA37 | 12-173 | EMALGQNVLVGFMTWEGYNYEDAIIMSRRLVKDDVYTSIHIEEYESEARDTKLGPEEITREIPNVGEDALKDLDEMGIIRIGAEVQD… |
| A0A3E0NV75 | 2-117 | NTLVLKLKQELDEQGNLEEFTNDVNEITDSDTLEHLDADGLPATGTHVSEGMLLVAKIGATKAYSKARLPNVLERATLAEQEVVRRI… |
| A0A2I0LFP5 | 341-522 | None |
| A0A6J5VLD4 | 163-312 | None |
| A0A6J5VRG1 | 2-102 | None |
| A0A6G3V3Q7 | 94-273 | None |
| A0A1R3L0T9 | 1-148 | None |
| A0A438DLS7 | 140-302 | None |
| A0A6S8SMV0 | 508-690 | None |
| A0A6B2LZ89 | 143-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.