DPCstruct | MC9817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 96 ± 8 aa |
| Standard deviation of domain lengths | 7.57 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 29.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0043 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A268HXM7 | 6-93 | ESHDPHIWLDPVLAQEQVNIIRDALIEADPDGQAIYEENAEAFNKELQALHEDFQAALEDAESRVFVVQHQAFGYLAQRYQLEQVAIG |
| A0A6M1X7T3 | 11-97 | PKMAIKEVSNIKDQLVKLYPKKAKVFETNAEKYLTKLKRLDADYTTSLKEAKQKSFVTQHAAFGYLALDYGLIQVPIAGLSPEEEPS |
| A0A1V4VKZ9 | 1-77 | None |
| G6ENA9 | 1-98 | None |
| A0A7W0A923 | 60-157 | None |
| A0A3S4J4C3 | 23-116 | None |
| A0A1I0WQS0 | 1-77 | None |
| A0A438B417 | 370-465 | None |
| A0A4Z1CC02 | 285-380 | None |
| D6PD30 | 63-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.