DPCstruct | MC9816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 96 ± 9 aa |
| Standard deviation of domain lengths | 8.51 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 95.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 41.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L7EDS6 | 6-106 | LLARIDFFHEQGCLISDHAINEMTFEETTEEEVEAIFHKRMSGHSLTEKEKIKFKTQTFIQLGQAYYERGWAMQLHINALRNNNTKM… |
| A0A6M1X733 | 1-102 | VLGQRIEYFHQHGCRVSDHALDILRYKEADETVLEEIFQKARANKLLSSDEIDAYRTETLIHLTHFYHSHNWTMQLHIHAYRNCNTQ… |
| A0A376SF39 | 1-71 | None |
| A0A077ZHQ5 | 222-322 | None |
| A0A377LUB7 | 43-143 | None |
| A0A7X7L648 | 1-84 | None |
| A0A2Z5Z6T8 | 147-246 | None |
| A0A351APA7 | 225-325 | None |
| A0A3S7QG63 | 19-119 | None |
| A0A6D0EN80 | 51-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.