DPCstruct | MC9814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 131 ± 14 aa |
| Standard deviation of domain lengths | 14.10 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838WQ31 | 1-103 | EGPALVRGTIYAGAGAGLLLALIYLGLGTIGRIIPNPAQYDNGAALLSDASNLTLGTAGQIVFALIVLLACITTAVGLITATAEYFS… |
| A0A6M1X6Q9 | 2-119 | RDLGFKDKKVTELTAKAGSLSVALEVMIYFGLVLLGAMSLNKMSLSENGGTALSQITNFYSGNFGASFLGVMVTLGVFTTAMGLVVS… |
| A0A0R1Q7F6 | 3-125 | None |
| A0A7Z7KMF1 | 90-223 | None |
| A0A484VX57 | 89-256 | None |
| R6Z768 | 1-128 | None |
| A0A380FGZ6 | 1-136 | None |
| A0A3D0GRM2 | 29-167 | None |
| A0A090R6B3 | 4-127 | None |
| A0A2G6DN48 | 66-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.