DPCstruct | MC9813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 71 ± 3 aa |
| Standard deviation of domain lengths | 3.36 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 55.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L1KEF0 | 1-70 | MIKTRFEAYLIIFALALGAMTRGAHYTVQYPGVGGYLLFAATAGAVFLGGAKILDALRYEREAREAGADT |
| A0A547PDG9 | 1-74 | MLKKIGRLFVIKNRFEAFVIIYALALGAMSRGVDYLEQYPGGWGWALFAATSGAVFLAGAKILDGLKAEKELAE |
| A0A2W5NZN5 | 11-80 | None |
| A0A2U1G2M6 | 1-67 | None |
| T0IJX2 | 42-113 | None |
| A0A0B1ZLR1 | 1-79 | None |
| A0A345YJQ9 | 3-71 | None |
| A0A2A4ID76 | 1-72 | None |
| A0A4Q5RN00 | 1-66 | None |
| A0A1J0V499 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.