DPCstruct | MC981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 82 ± 7 aa |
| Standard deviation of domain lengths | 7.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 19.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T4U2T4 | 1-78 | MIQQTSFSIYNSSDSDMEIIHEPEGFVYTLPIQEEIVIVTDSCLNSVQIKISSEENKIVVAILDEKSLYSVMYKGEDV |
| A0A2N3UFF8 | 2-94 | AVMDGRNDSKGWLVMWLEPLGEDRWLRPDETFRVRSDYNGDELAFSITFWVDDNDRSAGIENVAVRIENGDCYAEVVDRAGNLIECG… |
| A0A1M5JBF4 | 116-196 | None |
| A0A5M4FF94 | 18-102 | None |
| A0A840VIQ6 | 1-72 | None |
| A0A511N999 | 30-123 | None |
| K0K729 | 1-76 | None |
| A0A066Z2P1 | 5-95 | None |
| A0A519F542 | 45-135 | None |
| A0A2E2ZSK8 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.