DPCstruct | MC9808
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 181 ± 28 aa |
| Standard deviation of domain lengths | 27.60 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 40.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0MSN7 | 66-235 | QLHESEEKFFDQLKGGIHQCIARPYDTAAVALGVSLLLLPGPRRVLYRSTLGMFQSEEAIYRNTESKLATLKKTLESQGTQASAAEA… |
| A0A3B6HUP6 | 12-173 | SILVTISDALVLASKHQAEAIGCATVAGFILFRGPRRFLYRNTLGRFKTEKDLLNDVEQSMIEYKTSIESLRKDSKYTLDKVVIGES… |
| A0A5A7QMS6 | 130-296 | None |
| A0A6P5SSQ7 | 24-214 | None |
| A0A0A0KA31 | 5-209 | None |
| A0A453I6H9 | 1-143 | None |
| A0A0K9R9G3 | 82-268 | None |
| A0A4U6T3W7 | 2-210 | None |
| A0A059AEZ7 | 56-242 | None |
| A0A0E0GLS5 | 2-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.