DPCstruct | MC9807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 156 ± 30 aa |
| Standard deviation of domain lengths | 29.57 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351ATL3 | 27-182 | KIVIFFVFHSPCSNLSSMGKTLDEYGWSAPWRKPYYLNKQLRQASLYELVVYSAKGYNEMDVALEKADLKETFPSDFSRERICIYDN… |
| A0A832P3W3 | 2-144 | SKSFKEHGWQSKYFSQLQKRLKKCNEQNIIFKRVSVKKLYSALEDTNQLGKVDCSKKVVIYHDGGTSMSTLFGAIRNAFAHGSFQIK… |
| A0A1E3V0L7 | 33-186 | None |
| A0A7Y4YN07 | 41-148 | None |
| D4LCI2 | 68-241 | None |
| A0A3D5ULE4 | 36-185 | None |
| A0A6N3CR84 | 32-177 | None |
| A0A2D1TWN5 | 1-129 | None |
| A0A4T9T636 | 8-216 | None |
| A0A174A278 | 1-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.