DPCstruct | MC9803
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 77 ± 9 aa |
| Standard deviation of domain lengths | 9.13 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M2VJS4 | 412-484 | DVDAWDGYRANRNRVLDHLYDNEISNTIILAGDSHANWASDLARPNDTITYDPLTGHGAIGVEFAGTAVSSTS |
| A0A318E633 | 160-232 | NPDQWDGYAANRNRIFDQWAANGLRNNIVLSGDIHSSWAAELTRFPGNPATYSPLNGRGSVGAEFVCSAVTSG |
| A0A2W1D5S9 | 1-96 | None |
| A0A0K6GED4 | 343-418 | None |
| A0A0R2U837 | 19-81 | None |
| A0A1C4QTA8 | 31-98 | None |
| A0A1Y1HZF2 | 412-499 | None |
| A0A0S2KB49 | 1-67 | None |
| A0A139IHE1 | 102-181 | None |
| A0A838PNH1 | 5-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.