DPCstruct | MC9802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 167 ± 18 aa |
| Standard deviation of domain lengths | 17.98 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 27.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W1G7Q1 | 1-183 | MPTFSLGRLGRFRISRLPPSHTSSPTEHQKPLSTPPPEYKDIVEIDTKYYAPSQAQPPQCKTEQVRRFLIEILAMTFGANFDELNAA… |
| A0A6A6RR78 | 1-149 | MKRPSSNTSSAGIDTPPSSTSRESSPGPLADAATYNPQMQLRRYITEIMGFTFDVDFTLLNRALDPTVPISATSPTKSILTPHERAE… |
| A0A6A5TVR0 | 1-186 | None |
| A0A6A5WEZ0 | 1-150 | None |
| A0A3M7MC73 | 2-195 | None |
| A0A6A5ZSG0 | 1-146 | None |
| A0A6A5ZAZ6 | 5-180 | None |
| A0A7C8MEP9 | 140-309 | None |
| A0A7C8MQV2 | 34-219 | None |
| A0A2W1D5R7 | 19-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.