DPCstruct | MC9801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 154 ± 16 aa |
| Standard deviation of domain lengths | 15.71 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2AA30 | 81-228 | DHLNLPDENPKPTGPTKVLQILTDFNKNPKNIEEWAWIDWLFFATDYGTAPECRTDTLYHEERKMDPNDEDHTYYPGGEFPLKMPGF… |
| A0A2W1G4V1 | 19-181 | VSTSAAKPIRLMCTEVPDDDSGDISTSDKPNNPEPESAKHSVQILLSLANDRDYNWILFQGPAKIPVSPCPTYPKPFEAVSMSPSIH… |
| A0A2V1CY48 | 32-177 | None |
| A0A1M3TFR6 | 290-435 | None |
| A0A6A7A5Z8 | 211-362 | None |
| A0A395GKP2 | 534-664 | None |
| A0A5N5PUN9 | 196-335 | None |
| A0A4V1X6Z4 | 140-294 | None |
| A0A6A5SIF1 | 23-187 | None |
| A0A6A5SJQ5 | 275-441 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.