DPCstruct | MC980
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 108 ± 17 aa |
| Standard deviation of domain lengths | 16.79 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0768 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A517MQB7 | 50-173 | NRLRRELLHFTGDLERCFHPLNRRVIYTPGVQYLAEEAGAYWLIDAIASWIGSHSFVQAIQQDERLQTVHFWRLEVDSESRAAILTA… |
| A0A1T4SY67 | 8-119 | LNDQLKQFCGTENYTRHSFSRIHLTDGIVYAKDVHGLNWLVDKIAPQAINLKRHPFQCWKLSRVGKTGCFNLLCTDGNDNLLYKEII… |
| A0A6L5YC31 | 2-74 | None |
| A0A2N1SAN4 | 9-109 | None |
| A0A4R7RUV6 | 5-98 | None |
| A0A1M5CFL3 | 9-102 | None |
| A0A399ZTM4 | 115-246 | None |
| A0A292QVS0 | 5-146 | None |
| A0A220SD92 | 48-150 | None |
| A0A1Q8Z6L9 | 78-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.