DPCstruct | MC98
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 207 ± 13 aa |
| Standard deviation of domain lengths | 12.74 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7P9I2 | 22-206 | TDTQVFFDLLRGPAQAQVAERTILDGWHDSHASILLELHRFALRSARPRLVALLERATGQSFAEDIDAWWRWIWATNPGTHPQYSIF… |
| A0A3C0ECK2 | 1-216 | MRVIDASQPLPPTVGPKLSNPGNLAYDALMAAALDSLPHFNRLGDDSGVSRFGRVPVNLDQVAGQMVDSGDIVYAPVLIDFLRMQLY… |
| A0A7V9PQ76 | 3-197 | None |
| K9Z663 | 56-249 | None |
| A0A6L8E4F3 | 142-341 | None |
| A0A355B031 | 1-227 | None |
| A0A6L7TPR8 | 76-304 | None |
| A0A2E0LXB0 | 129-324 | None |
| A0A2N2LK93 | 235-454 | None |
| A0A6N6KT93 | 372-574 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.