DPCstruct | MC9799
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 98 ± 10 aa |
| Standard deviation of domain lengths | 9.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.59 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF07830- CL0238 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060XTP6 | 1-87 | MSIIIVTFPGAPQVSQEALQKEAELETILEAKVEEIVNLLKSRDKDPDLLYVMKFLVSEDIPGLPPGGGVTSKRDCVISAYQKFVTP |
| A0A2R9ABK1 | 1-97 | MTCILVCFPGAPRPSEEAIRRELALDAALGRRIAELCASAQKPPSLNTVFRTLASEDIPDLPPGGGLDCKATVIAEVYSQICQVSEE… |
| A0A3Q7UC81 | 247-337 | None |
| A0A6B0S6A5 | 179-294 | None |
| A0A7R8CVN1 | 206-294 | None |
| A0A7G9PJ42 | 138-236 | None |
| A0A643CEN0 | 183-292 | None |
| A0A653BPV3 | 1-86 | None |
| A0A498N651 | 297-403 | None |
| A0A1B0AGH8 | 19-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.