DPCstruct | MC9794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 117 ± 16 aa |
| Standard deviation of domain lengths | 15.55 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q7I9D9 | 49-176 | FIRLTHSRPFEWGTSDCSLMVADWCVENGHEDPASAWRGTYTTEAECRALIAQRGDLAAVVAACAAMARLKVLAEPELGAVAVVGSK… |
| A0A4S8NH92 | 1-110 | MDCCLVIAEWAKWLGYPDAAEHLRGAYKAGQGQLDILAARGGAVSLIEECALSIGATMVDEPQLGDFGAVGSSRNMTRQFGVIHDGE… |
| H0HQT0 | 6-139 | None |
| A0A166R4W1 | 6-99 | None |
| A0A4R6FJZ9 | 3-92 | None |
| A0A840ZPA1 | 52-174 | None |
| A0A3B9EFJ7 | 8-149 | None |
| A0A285QXY4 | 19-147 | None |
| A0A545B6D1 | 7-129 | None |
| A4WS01 | 8-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.