DPCstruct | MC9793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 243 |
|---|---|
| Mean domain length (aa) | 214 ± 47 aa |
| Standard deviation of domain lengths | 47.17 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 88.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.82 |
| Pfam Score | 99.25 |
| Assigned Pfam label(s) | PF09992- PF07833 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7IYR0 | 277-392 | ITIDNVILTSDGQRIYPRSIVSGNPKNVGLGETLDTEGERGDASSRHPRTCIGYTQDRKHIIMMVIDGRTSASAGVTTSMLADVMRY… |
| A0A0F4W6S6 | 14-202 | DMAEEHNAIAAINGGAFVDESSDGTVYAGTGARPGGFVISNGKVVYPTENVDKDNVENVVAFTKSGKLIVGDHSLRELEKLNVQEAM… |
| A0A1Y6BNK1 | 396-678 | None |
| A0A3S1BCH3 | 6-181 | None |
| A0A5D8YMP2 | 453-563 | None |
| A0A1Y4HFA8 | 472-692 | None |
| A0A6A5WVD4 | 5-248 | None |
| A0A1T5K806 | 459-697 | None |
| A0A7X9KDK6 | 11-203 | None |
| A0A7X8KN36 | 128-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.