DPCstruct | MC9792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 154 ± 32 aa |
| Standard deviation of domain lengths | 31.78 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08812 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7IGH6 | 2-109 | FVERQYEEYINLLTTFVRMQVPRVPELHVFVQKNGSYKVEGTKPFEIPEDVINGFGIQSNDPVIDDDDFMIGFLLTCAPVRIFIHNS… |
| A0A0F4VSH3 | 45-206 | RINNIIEKIRQCIGEKQEINVDGFITFRLRMLREDIEKIVDKVVEKYMVEKEYEEFVRLLKYFVDIQECKIEKIIISIEAGSHYIIK… |
| A0A356B1N6 | 36-182 | None |
| A0A7C6ZGT7 | 214-355 | None |
| A0A7X7YN10 | 11-140 | None |
| A0A1S9CKY3 | 110-219 | None |
| A0A7C7DU85 | 122-314 | None |
| A0A6M6E5A0 | 83-226 | None |
| A0A3C0FC74 | 2-137 | None |
| A0A7X8DQQ6 | 6-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.