DPCstruct | MC9790
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 362 ± 51 aa |
| Standard deviation of domain lengths | 51.31 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 13.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V2NGJ7 | 2-397 | ENWKKQMYMIFPNGSIVNPSVKNKEERYTSILQELIEDVQPLRNSGNCIACGRRDADRSLYKSEVPLTGSGKFVNFYSNAANGADYC… |
| A0A4Y6D6P0 | 2-384 | LWRTLRGVPATRLPFIARAQGTDNGDAEKAWKRLTSKKAGTVQLSSTDYLGAMDRNADGVSFEDAPREWFLLHFWPYVTQVHVPRAL… |
| A0A7X8D4P7 | 71-486 | None |
| M6K8K7 | 2-358 | None |
| A0A847D699 | 29-423 | None |
| A0A7V4SW51 | 19-400 | None |
| A0A838QPR4 | 1-256 | None |
| A0A0C5XFS4 | 175-550 | None |
| A0A3D6D8T8 | 66-422 | None |
| A0A101DJX8 | 1-428 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.