DPCstruct | MC9789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 183 ± 26 aa |
| Standard deviation of domain lengths | 25.82 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 23.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S5CST4 | 21-189 | RCCPYQVVGTVIRSKIRCFTRKDVSQRSNDPALILILESPHIDEFKVNPPEPAKGWTVTNIKDYLYRFKSYLPTNDRELILVNAIQY… |
| A0A4Y6D2W4 | 177-358 | QFRYDKLVPDKAIAVCGPTQLQEPQDPLDEWAPSDQGNAIVVVLESPHEEEYGPDFTPLGPLRRPSSRTRLRGQLPRLLQEAELDWA… |
| D1ALD1 | 14-152 | None |
| A0A510ULU5 | 3-142 | None |
| A0A7G1G5J5 | 29-239 | None |
| A0A7Y4IIC3 | 38-246 | None |
| W7CWD1 | 18-215 | None |
| A0A2T6C038 | 33-232 | None |
| A0A2G4WRC2 | 9-151 | None |
| A0A1J5BYE5 | 22-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.