DPCstruct | MC9788
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 101 ± 7 aa |
| Standard deviation of domain lengths | 7.35 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 60.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7FLG1 | 38-144 | MNQKHLLRFIKRAMKKYPDEIVHVERGRGQTLREVFETMNLTAYDLSVDTLDMHADRNTFHRFDKFNSKYNPIGESILREIFIKTDN… |
| A0A0R0GRB6 | 1-87 | MNQKHLLRFIKSKLRKEPDEVVIFRDWTYLTLEEVFKSLDLSGYDLNVDLLDVHADKSTFHRFDKFNLKYNPCGQSRLREIFLKQDN |
| A0A668AM50 | 211-309 | None |
| A0A086JZI8 | 104-212 | None |
| A0A833S991 | 82-181 | None |
| A0A0W4ZD51 | 266-370 | None |
| A0A226ETE9 | 540-639 | None |
| A0A672PUC7 | 291-389 | None |
| A0A183P5I6 | 1-101 | None |
| H8ZDC3 | 136-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.