DPCstruct | MC9787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 196 ± 41 aa |
| Standard deviation of domain lengths | 41.48 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 71.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 20.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1ST21 | 3-120 | RLNAPPLVQFAVLHCPPVEVGRVARDVPRQRVTPLLASLGELLDKSPHLDVVLSWIQAICTHHGAELREGAAVAMPTLRSVMEVVGR… |
| A0A0R0G3C9 | 3-178 | EKLAALSLPDKNKFRRDKEQDSSDPTKPPSADSVHVLLGQALNADGRTLLLDCLYTQDEKVITKSIAQLNPSNVLKFLHPLISINES… |
| A0A3B0N607 | 18-192 | None |
| M1V776 | 822-967 | None |
| A0A0D3CAH5 | 16-207 | None |
| A0A0C2IPI6 | 3-210 | None |
| A0A5S6QQH7 | 1-239 | None |
| A0A7R9XVM2 | 382-620 | None |
| A0A812ZSU4 | 584-802 | None |
| F0WR50 | 956-1146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.