DPCstruct | MC9786
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 70 ± 8 aa |
| Standard deviation of domain lengths | 8.45 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 58.16 |
| Pfam Score | 87.15 |
| Assigned Pfam label(s) | CL0061- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9IMS8 | 2-55 | AAKEAETVASISCSGHGRAFLDGLVVNGKPICECNACFAGPDCSDFLPECVVDA |
| A0A0R0FZ67 | 7-69 | TWSTRAAEEAEVVAAIPCSGHGRAYLDGLILKDMNKSLCECNSCYAGSDCSQFLSDCPANADG |
| A0A2G3ANJ2 | 32-99 | None |
| A0A0L9VKI9 | 7-66 | None |
| A0A6D2JTV7 | 27-95 | None |
| F6H6R3 | 33-97 | None |
| A0A1R3JUZ8 | 33-98 | None |
| B9SED3 | 728-810 | None |
| B6U817 | 55-117 | None |
| A0A7J7DSH2 | 81-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.