DPCstruct | MC9782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 119 ± 24 aa |
| Standard deviation of domain lengths | 24.08 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0398 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1GI39 | 168-304 | IRAETLDDYLKDYRDTFSRAVGFRPTGWNYRPPNSRFTESPLVQTVLHSNNWKSNFTMRDLVPQRGSTSRASSFGVPYSEHSSFREL… |
| A0A0R0EKG2 | 264-362 | LLTNKGYLKTYKGQFTAILAFRPTGWTFSERISNDLELIKPVSKRNITIYGVPYSEHSSFTELRDFVQFLKPDKIIPTVNVWNAANR… |
| A0A6J5WVX3 | 242-399 | None |
| A0A4P9Y700 | 345-472 | None |
| A0A6P6G3P0 | 22-149 | None |
| A0A446MC75 | 300-402 | None |
| A0A5B8MKA3 | 203-354 | None |
| A0A1U8FQ15 | 242-406 | None |
| A0A821A2E3 | 475-574 | None |
| A0A2U1QNX7 | 102-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.